PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy017120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 814aa    MW: 91453.5 Da    PI: 6.6409
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59524560PU_refUnigeneView CDS
gnl|UG|Ahy#S58471180PU_unrefUnigeneView CDS
PUT-171a-Arachis_hypogaea-230891PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.91.5e-1164378131373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+avs++d++ a++lL+++++++ p gd+ qRla yf+ +L+ar+a++++++    ++ + ++ + ++ l+a+++f  ++P+ kf+h+  N+
  Ahy017120 437 LRTLLVLCAQAVSANDQRTANELLKQIRQHSLPFGDAYQRLARYFADGLEARMAGTGPGIHIFYASLSYKKFSAADFLKAYQVFISACPFKKFAHFFSNK 536
                5789****************************************************99998777777777777*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +Il+ +e++e++Hi+Df+i +G+QWp L++ +a+R++gpp+lRiTg++ p++g   +e++eetg+rLak++++++vpfe+++++++++e++++e+L++k 
  Ahy017120 537 MILNIAEKAETLHIVDFGILYGFQWPILIKFIAKRDGGPPKLRITGIEYPQAGfrPTERIEETGRRLAKYCKRFNVPFEYKAIASRHWETIQIEDLNIKD 636
                ****************************************************9*****************************9999************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn+ ++ ++ll+e+v+++s+r++vL+l+++++P ++  +  + ++n++ Fl+rf eal +ysa++d++++ +pr++++r+++Ere+lgrei+nvv
  Ahy017120 637 NEVVAVNCLVRFKNLLEETVEVNSPRNAVLNLIRRINPAIFAQTVVNGSYNAPFFLTRFREALFHYSAIYDMFDTLIPRNNSWRSMLEREFLGREIMNVV 736
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg er+er et+++W++r ++aGF+++pl++  +++ ++ l++ +   + +  +e+++++++gWk+r L++ S+W
  Ahy017120 737 ACEGLERVERPETYKQWQARNSRAGFRQLPLDKALMSKFRSKLKEWYqhHKDFVFDEDNNWMLQGWKGRILYASSCW 813
                *******************************************998756677************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.991411792IPR005202Transcription factor GRAS
PfamPF035145.3E-114437813IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
XYINAYGFGD YGGALLSDFN DWDLHRQYNH PFDLTPSNAF DRFDADTFGL HAHAVSNSGS  60
SEPFVPPSSA SRVEKSMPGS AFGAVASMPD PSVEDTDFSE TVRYISQILL EENFEDKPCM  120
CYNPLSLQDT EKSFYDALNQ EFPLSPNEHP LDIHQNLESP DGVSAGSFPT GSSGGCSNSN  180
SSSTSTSSSE NHLSSHDFKT LSPDTPVSGD SSLQFDSHSH LISHVPSQLH LPQHALTSIG  240
DGVFDLDPSA TKLLAQNIFS NADSILQFKR GLEEASKFLP PGPRLSIGLE SSSMHAEESK  300
RRVEKAAVPV MVENDAKERS NRVVAGPYHI VPATTKAAKN TAARSLDGVK SRKHHARQGD  360
DGEEERCNKQ SAVSVEEESE ISEMFDKVLL SVENVPLSAE QQGGLVVDTQ LIEQPHSSEG  420
GRSRSKKKGR KKETVDLRTL LVLCAQAVSA NDQRTANELL KQIRQHSLPF GDAYQRLARY  480
FADGLEARMA GTGPGIHIFY ASLSYKKFSA ADFLKAYQVF ISACPFKKFA HFFSNKMILN  540
IAEKAETLHI VDFGILYGFQ WPILIKFIAK RDGGPPKLRI TGIEYPQAGF RPTERIEETG  600
RRLAKYCKRF NVPFEYKAIA SRHWETIQIE DLNIKDNEVV AVNCLVRFKN LLEETVEVNS  660
PRNAVLNLIR RINPAIFAQT VVNGSYNAPF FLTRFREALF HYSAIYDMFD TLIPRNNSWR  720
SMLEREFLGR EIMNVVACEG LERVERPETY KQWQARNSRA GFRQLPLDKA LMSKFRSKLK  780
EWYQHHKDFV FDEDNNWMLQ GWKGRILYAS SCWV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-454418138374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935606.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0L9UNY40.0A0A0L9UNY4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SG750.0A0A0S3SG75_PHAAN; Uncharacterized protein
STRINGGLYMA13G41240.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14